SCOP 1.63: Domain d1jmvc_: 1jmv C:

Lineage for d1jmvc_ (1jmv C:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families)
   share similar mode of ligand (Adenosine group) binding
   the first three families are more closely related to each other as the last two families are

5. Family c.26.2.4: Universal stress protein-like [52436] (2 proteins)

6. Protein Universal stress protein A, UspA [69461] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [69462] (1 PDB entry)
   the nucleotide-binding is not known

8. Domain d1jmvc_: 1jmv C: [66899]

Details for d1jmvc_

PDB Entry: 1jmv, 1.85 Å

PDB Description: Structure of Haemophylus influenzae Universal Stress Protein At 1.85A Resolution

SCOP Domain Sequences for d1jmvc_:

Sequence, based on SEQRES records:

>d1jmvc_ c.26.2.4 (C:) Universal stress protein A, UspA {Haemophilus influenzae}
mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr
istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms
strqvmntikidmlvvpl

Sequence, based on observed residues (ATOM records):

>d1jmvc_ c.26.2.4 (C:) Universal stress protein A, UspA {Haemophilus influenzae}
mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsytglidvnmssmqdtet
qkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklmsstrqv
mntikidmlvvpl

Timeline for d1jmvc_:

• d1jmvc_ first appeared in SCOP 1.59
  
• d1jmvc_ appears in SCOP 1.61
  
• d1jmvc_ appears in SCOP 1.65
  
• d1jmvc_ appears in the current release, SCOPe 2.08