Lineage for d1jmvc_ (1jmv C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121268Fold c.29: ETFP adenine nucleotide-binding domain-like [52430] (1 superfamily)
  4. 121269Superfamily c.29.1: ETFP adenine nucleotide-binding domain-like [52431] (2 families) (S)
  5. 121280Family c.29.1.2: Universal stress protein-like [52436] (2 proteins)
  6. 121285Protein Universal stress protein A, UspA [69461] (1 species)
  7. 121286Species Haemophilus influenzae [TaxId:727] [69462] (1 PDB entry)
  8. 121289Domain d1jmvc_: 1jmv C: [66899]

Details for d1jmvc_

PDB Entry: 1jmv (more details), 1.85 Å

PDB Description: Structure of Haemophylus influenzae Universal Stress Protein At 1.85A Resolution

SCOP Domain Sequences for d1jmvc_:

Sequence, based on SEQRES records: (download)

>d1jmvc_ c.29.1.2 (C:) Universal stress protein A, UspA {Haemophilus influenzae}
mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr
istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms
strqvmntikidmlvvpl

Sequence, based on observed residues (ATOM records): (download)

>d1jmvc_ c.29.1.2 (C:) Universal stress protein A, UspA {Haemophilus influenzae}
mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsytglidvnmssmqdtet
qkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklmsstrqv
mntikidmlvvpl

SCOP Domain Coordinates for d1jmvc_:

Click to download the PDB-style file with coordinates for d1jmvc_.
(The format of our PDB-style files is described here.)

Timeline for d1jmvc_: