SCOPe 2.08: Domain d1jmvb_: 1jmv B:

Lineage for d1jmvb_ (1jmv B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
   Pfam PF00582

6. Protein Universal stress protein A, UspA [69461] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [69462] (1 PDB entry)
   the nucleotide-binding is not known

8. Domain d1jmvb_: 1jmv B: [66898]
   structural genomics
   complexed with so4

Details for d1jmvb_

PDB Entry: 1jmv, 1.85 Å

PDB Description: Structure of Haemophylus influenzae Universal Stress Protein At 1.85A Resolution

PDB Compounds: (B:) Universal Stress Protein A

SCOPe Domain Sequences for d1jmvb_:

Sequence, based on SEQRES records:

>d1jmvb_ c.26.2.4 (B:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]}
mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr
istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms
strqvmntikidmlvvplr

Sequence, based on observed residues (ATOM records):

>d1jmvb_ c.26.2.4 (B:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]}
mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmsqdris
tetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklmsst
rqvmntikidmlvvplr

Timeline for d1jmvb_:

• d1jmvb_ first appeared in SCOP 1.59
  
• d1jmvb_ appears in SCOPe 2.07