Lineage for d1jmva_ (1jmv A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    the first three families are more closely related to each other as the last two families are
  5. 242351Family c.26.2.4: Universal stress protein-like [52436] (2 proteins)
  6. 242356Protein Universal stress protein A, UspA [69461] (1 species)
  7. 242357Species Haemophilus influenzae [TaxId:727] [69462] (1 PDB entry)
    the nucleotide-binding is not known
  8. 242358Domain d1jmva_: 1jmv A: [66897]

Details for d1jmva_

PDB Entry: 1jmv (more details), 1.85 Å

PDB Description: Structure of Haemophylus influenzae Universal Stress Protein At 1.85A Resolution

SCOP Domain Sequences for d1jmva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae}
mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr
istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms
strqvmntikidmlvvplrd

SCOP Domain Coordinates for d1jmva_:

Click to download the PDB-style file with coordinates for d1jmva_.
(The format of our PDB-style files is described here.)

Timeline for d1jmva_: