Lineage for d1jmva_ (1jmv A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178723Fold c.29: ETFP adenine nucleotide-binding domain-like [52430] (1 superfamily)
  4. 178724Superfamily c.29.1: ETFP adenine nucleotide-binding domain-like [52431] (2 families) (S)
  5. 178735Family c.29.1.2: Universal stress protein-like [52436] (2 proteins)
  6. 178740Protein Universal stress protein A, UspA [69461] (1 species)
  7. 178741Species Haemophilus influenzae [TaxId:727] [69462] (1 PDB entry)
  8. 178742Domain d1jmva_: 1jmv A: [66897]

Details for d1jmva_

PDB Entry: 1jmv (more details), 1.85 Å

PDB Description: Structure of Haemophylus influenzae Universal Stress Protein At 1.85A Resolution

SCOP Domain Sequences for d1jmva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmva_ c.29.1.2 (A:) Universal stress protein A, UspA {Haemophilus influenzae}
mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr
istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms
strqvmntikidmlvvplrd

SCOP Domain Coordinates for d1jmva_:

Click to download the PDB-style file with coordinates for d1jmva_.
(The format of our PDB-style files is described here.)

Timeline for d1jmva_: