Lineage for d1jmui_ (1jmu I:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445443Fold d.196: Outer capsid protein sigma 3 [64464] (1 superfamily)
    unusual fold
  4. 1445444Superfamily d.196.1: Outer capsid protein sigma 3 [64465] (1 family) (S)
    automatically mapped to Pfam PF00979
  5. 1445445Family d.196.1.1: Outer capsid protein sigma 3 [64466] (1 protein)
  6. 1445446Protein Outer capsid protein sigma 3 [64467] (1 species)
  7. 1445447Species Reovirus [TaxId:10891] [64468] (3 PDB entries)
  8. 1445452Domain d1jmui_: 1jmu I: [66896]
    Other proteins in same PDB: d1jmu.1, d1jmu.2, d1jmu.3
    complexed with bog, cl, so4, zn

Details for d1jmui_

PDB Entry: 1jmu (more details), 2.8 Å

PDB Description: crystal structure of the reovirus mu1/sigma3 complex
PDB Compounds: (I:) sigma 3 protein

SCOPe Domain Sequences for d1jmui_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmui_ d.196.1.1 (I:) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]}
mevclpnghqivdlinnafegrvsiysaqegwdktisaqpdmmvcggavvcmhclgvvgs
lqrklkhlphhrcnqqirhqdyvdvqfadrvtahwkrgmlsfvcqmhammndvspedldr
vrteggslvelnwlqvdpnsmfrsihsswtdplqvvddldtkldqywtalnlmidssdlv
pnfmmrdpshafngvrlegdarqtqfsrtfdsrsslewgvmvydyselehdpskgrayrk
elvtpardfghfglshysrattpilgkmpavfsgmltgnckmypfikgtaklktvrklvd
svnhawgvekiryalgpggmtgwynrtmqqapivltpaaltmfsdttkfgdldypvmigd
pmilg

SCOPe Domain Coordinates for d1jmui_:

Click to download the PDB-style file with coordinates for d1jmui_.
(The format of our PDB-style files is described here.)

Timeline for d1jmui_: