SCOP 1.63: Domain d1jmsa1: 1jms A:148-242

Lineage for d1jmsa1 (1jms A:148-242)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins)

6. Protein Terminal deoxynucleotidyl transferase [69042] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [69043] (3 PDB entries)

8. Domain d1jmsa1: 1jms A:148-242 [66889]
   Other proteins in same PDB: d1jmsa3, d1jmsa4
   complexed with mg, na

Details for d1jmsa1

PDB Entry: 1jms, 2.36 Å

PDB Description: Crystal Structure of the Catalytic Core of Murine Terminal Deoxynucleotidyl Transferase

SCOP Domain Sequences for d1jmsa1:

Sequence; same for both SEQRES and ATOM records:

>d1jmsa1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus)}
kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
mkdtegipclgdkvksiiegiiedgesseakavln

Timeline for d1jmsa1:

• d1jmsa1 first appeared in SCOP 1.59
  
• d1jmsa1 appears in SCOP 1.61
  
• d1jmsa1 appears in SCOP 1.65
  
• d1jmsa1 appears in the current release, SCOPe 2.08