Lineage for d1jmsa1 (1jms A:148-242)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2324612Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2324613Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 protein domains)
  6. 2324834Protein Terminal deoxynucleotidyl transferase [69042] (1 species)
  7. 2324835Species Mouse (Mus musculus) [TaxId:10090] [69043] (3 PDB entries)
  8. 2324836Domain d1jmsa1: 1jms A:148-242 [66889]
    Other proteins in same PDB: d1jmsa3, d1jmsa4
    complexed with mg, na

Details for d1jmsa1

PDB Entry: 1jms (more details), 2.36 Å

PDB Description: Crystal Structure of the Catalytic Core of Murine Terminal Deoxynucleotidyl Transferase
PDB Compounds: (A:) terminal deoxynucleotidyltransferase

SCOPe Domain Sequences for d1jmsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmsa1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]}
kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
mkdtegipclgdkvksiiegiiedgesseakavln

SCOPe Domain Coordinates for d1jmsa1:

Click to download the PDB-style file with coordinates for d1jmsa1.
(The format of our PDB-style files is described here.)

Timeline for d1jmsa1: