Lineage for d1jmqa_ (1jmq A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077689Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2077690Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2077691Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2077778Protein Yap65 ww domain [69330] (1 species)
  7. 2077779Species Human (Homo sapiens) [TaxId:9606] [69331] (4 PDB entries)
  8. 2077781Domain d1jmqa_: 1jmq A: [66888]
    in complex with gtppppytvg peptide
    mutant

Details for d1jmqa_

PDB Entry: 1jmq (more details)

PDB Description: yap65 (l30k mutant) ww domain in complex with gtppppytvg peptide
PDB Compounds: (A:) 65 kda yes-associated protein

SCOPe Domain Sequences for d1jmqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]}
feipddvplpagwemaktssgqryfknhidqtttwqdprkamlsqm

SCOPe Domain Coordinates for d1jmqa_:

Click to download the PDB-style file with coordinates for d1jmqa_.
(The format of our PDB-style files is described here.)

Timeline for d1jmqa_: