SCOP 1.67: Domain d1jmla_: 1jml A:

Lineage for d1jmla_ (1jml A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries)

8. Domain d1jmla_: 1jml A: [66887]
   b1 domain; an obligate dimer designed mutant

Details for d1jmla_

PDB Entry: 1jml, 1.9 Å

PDB Description: conversion of monomeric protein l to an obligate dimer by computational protein design

SCOP Domain Sequences for d1jmla_:

Sequence; same for both SEQRES and ATOM records:

>d1jmla_ d.15.7.1 (A:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
mhhhhhhgmeevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvv
pkaytlnikfag

Timeline for d1jmla_:

• d1jmla_ first appeared in SCOP 1.59
  
• d1jmla_ appears in SCOP 1.65
  
• d1jmla_ appears in SCOP 1.69
  
• d1jmla_ appears in the current release, SCOPe 2.08, called d1jmla1