Lineage for d1jmeb_ (1jme B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100199Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 100200Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 100201Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 100218Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 100219Species Bacillus megaterium [TaxId:1404] [48269] (8 PDB entries)
  8. 100227Domain d1jmeb_: 1jme B: [66886]

Details for d1jmeb_

PDB Entry: 1jme (more details), 2 Å

PDB Description: crystal structure of phe393his cytochrome p450 bm3

SCOP Domain Sequences for d1jmeb_:

Sequence, based on SEQRES records: (download)

>d1jmeb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd
petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv
psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr
dktiwgddveefrperfenpsaipqhafkphgngqracigqqfalheatlvlgmmlkhfd
fedhtnyeldiketltlkpegfvvkakskkipl

Sequence, based on observed residues (ATOM records): (download)

>d1jmeb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium}
kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac
desrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdi
avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald
eamnklnkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeni
ryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyv
gmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveef
rperfenpsaipqhafkphgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldik
etltlkpegfvvkakskkipl

SCOP Domain Coordinates for d1jmeb_:

Click to download the PDB-style file with coordinates for d1jmeb_.
(The format of our PDB-style files is described here.)

Timeline for d1jmeb_: