SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1jm6b1 (1jm6 B:1002-1169)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993175Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1993176Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 protein domains)
  6. 1993182Protein Pyruvate dehydrogenase kinase [69016] (2 species)
  7. 1993192Species Norway rat (Rattus norvegicus), isozyme 2 [TaxId:10116] [69017] (1 PDB entry)
  8. 1993194Domain d1jm6b1: 1jm6 B:1002-1169 [66878]
    Other proteins in same PDB: d1jm6a2, d1jm6b2
    complexed with adp, mg

Details for d1jm6b1

PDB Entry: 1jm6 (more details), 2.5 Å

PDB Description: Pyruvate dehydrogenase kinase, isozyme 2, containing ADP
PDB Compounds: (B:) Pyruvate dehydrogenase kinase, isozyme 2

SCOPe Domain Sequences for d1jm6b1:

Sequence, based on SEQRES records: (download)

>d1jm6b1 a.29.5.1 (B:1002-1169) Pyruvate dehydrogenase kinase {Norway rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]}
naslagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkein
llpdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvpt
maqgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Sequence, based on observed residues (ATOM records): (download)

>d1jm6b1 a.29.5.1 (B:1002-1169) Pyruvate dehydrogenase kinase {Norway rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]}
naslagapkyiehfskfspsplsmkqfldfgacektsftflrqelpvrlanimkeinllp
drvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaq
gvleyqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d1jm6b1:

Click to download the PDB-style file with coordinates for d1jm6b1.
(The format of our PDB-style files is described here.)

Timeline for d1jm6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jm6b2