Lineage for d1jm6b1 (1jm6 B:1002-1169)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993175Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1993176Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 protein domains)
  6. 1993182Protein Pyruvate dehydrogenase kinase [69016] (2 species)
  7. 1993192Species Norway rat (Rattus norvegicus), isozyme 2 [TaxId:10116] [69017] (1 PDB entry)
  8. 1993194Domain d1jm6b1: 1jm6 B:1002-1169 [66878]
    Other proteins in same PDB: d1jm6a2, d1jm6b2
    complexed with adp, mg

Details for d1jm6b1

PDB Entry: 1jm6 (more details), 2.5 Å

PDB Description: Pyruvate dehydrogenase kinase, isozyme 2, containing ADP
PDB Compounds: (B:) Pyruvate dehydrogenase kinase, isozyme 2

SCOPe Domain Sequences for d1jm6b1:

Sequence, based on SEQRES records: (download)

>d1jm6b1 a.29.5.1 (B:1002-1169) Pyruvate dehydrogenase kinase {Norway rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]}
naslagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkein
llpdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvpt
maqgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Sequence, based on observed residues (ATOM records): (download)

>d1jm6b1 a.29.5.1 (B:1002-1169) Pyruvate dehydrogenase kinase {Norway rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]}
naslagapkyiehfskfspsplsmkqfldfgacektsftflrqelpvrlanimkeinllp
drvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaq
gvleyqniqyfldrfylsrisirmlinqhtlifd

SCOPe Domain Coordinates for d1jm6b1:

Click to download the PDB-style file with coordinates for d1jm6b1.
(The format of our PDB-style files is described here.)

Timeline for d1jm6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jm6b2