Class k: Designed proteins [58788] (44 folds) |
Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily) |
Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) |
Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins) this is not a true family |
Protein Artificial diiron protein [58837] (1 species) dimeric alpha-hairpin fold |
Species Synthetic, different variants [58838] (12 PDB entries) |
Domain d1jm0f_: 1jm0 F: [66875] complexed with dms, mn |
PDB Entry: 1jm0 (more details), 1.7 Å
SCOPe Domain Sequences for d1jm0f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jm0f_ k.8.1.1 (F:) Artificial diiron protein {Synthetic, different variants} dylrellklelqaikqyrealeyvklpvlakiledeekhiewletilg
Timeline for d1jm0f_: