Lineage for d1jltb_ (1jlt B:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) 
Protein Snake phospholipase A2 [48624] (13 species) Species Sand viper (Vipera ammodytes meridionalis), vipoxin [48635] (3 PDB entries) 
Domain d1jltb_: 1jlt B: [66868]
Details for d1jltb_
PDB Entry: 1jlt (more details), 1.4 Å
PDB Description: vipoxin complex
SCOP Domain Sequences for d1jltb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jltb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin}
nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
laiysysfkkgnivcgknngclrdicecdrvaancfhqnkntynknykflsssrcrqtse
qc
SCOP Domain Coordinates for d1jltb_:
Click to download the PDB-style file with coordinates for d1jltb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jltb_:
- d1jltb_ is new in SCOP 1.59
- d1jltb_ appears in SCOP 1.61
- d1jltb_ appears in the current release, SCOPe 2.08
View in 3D
