![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Uracil PRTase, Upp [53293] (5 species) |
![]() | Species Toxoplasma gondii [TaxId:5811] [53295] (6 PDB entries) |
![]() | Domain d1jlsc_: 1jls C: [66865] complexed with mg, po4, prp, ura; mutant |
PDB Entry: 1jls (more details), 2.5 Å
SCOPe Domain Sequences for d1jlsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlsc_ c.61.1.1 (C:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgt
Timeline for d1jlsc_: