Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) |
Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein) |
Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species) |
Species Escherichia coli [TaxId:562] [56083] (6 PDB entries) |
Domain d1jlle2: 1jll E:1-238 [66858] Other proteins in same PDB: d1jlla1, d1jlla2, d1jllb1, d1jlld1, d1jlld2, d1jlle1 complexed with coa, po4, so4; mutant |
PDB Entry: 1jll (more details), 2.69 Å
SCOP Domain Sequences for d1jlle2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlle2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli} mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki fmglatiflerdlaliainplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe
Timeline for d1jlle2: