Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species) |
Species Escherichia coli [TaxId:562] [51902] (11 PDB entries) |
Domain d1jlld1: 1jll D:1-121 [66855] Other proteins in same PDB: d1jlla2, d1jllb1, d1jllb2, d1jlld2, d1jlle1, d1jlle2 complexed with coa, po4, so4; mutant |
PDB Entry: 1jll (more details), 2.69 Å
SCOPe Domain Sequences for d1jlld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlld1 c.2.1.8 (D:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig p
Timeline for d1jlld1: