SCOPe 2.03: Domain d1jllb1: 1jll B:239-388

Lineage for d1jllb1 (1jll B:239-388)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)

7. Species Escherichia coli [TaxId:562] [52216] (11 PDB entries)

8. Domain d1jllb1: 1jll B:239-388 [66853]
   Other proteins in same PDB: d1jlla1, d1jlla2, d1jllb2, d1jlld1, d1jlld2, d1jlle2
   complexed with coa, po4, so4; mutant

Details for d1jllb1

PDB Entry: 1jll, 2.69 Å

PDB Description: crystal structure analysis of the e197betaa mutant of e. coli scs

PDB Compounds: (B:) succinyl-CoA synthetase beta subunit

SCOPe Domain Sequences for d1jllb1:

Sequence; same for both SEQRES and ATOM records:

>d1jllb1 c.23.4.1 (B:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaavegk

Timeline for d1jllb1:

• d1jllb1 first appeared in SCOP 1.59
  
• d1jllb1 appears in SCOPe 2.02
  
• d1jllb1 appears in SCOPe 2.04
  
• d1jllb1 appears in the current release, SCOPe 2.08