SCOPe 2.07: Domain d1jlla2: 1jll A:122-287

Lineage for d1jlla2 (1jll A:122-287)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)

7. Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)

8. Domain d1jlla2: 1jll A:122-287 [66852]
   Other proteins in same PDB: d1jlla1, d1jllb1, d1jllb2, d1jlld1, d1jlle1, d1jlle2
   complexed with coa, po4, so4; mutant

Details for d1jlla2

PDB Entry: 1jll, 2.69 Å

PDB Description: crystal structure analysis of the e197betaa mutant of e. coli scs

PDB Compounds: (A:) succinyl-CoA synthetase alpha subunit

SCOPe Domain Sequences for d1jlla2:

Sequence; same for both SEQRES and ATOM records:

>d1jlla2 c.23.4.1 (A:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl

Timeline for d1jlla2:

• d1jlla2 first appeared in SCOP 1.59
  
• d1jlla2 appears in SCOPe 2.06
  
• d1jlla2 appears in the current release, SCOPe 2.08