Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) |
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species) |
Species Escherichia coli [TaxId:562] [52213] (11 PDB entries) |
Domain d1jlla2: 1jll A:122-287 [66852] Other proteins in same PDB: d1jlla1, d1jllb1, d1jllb2, d1jlld1, d1jlle1, d1jlle2 complexed with coa, po4, so4; mutant |
PDB Entry: 1jll (more details), 2.69 Å
SCOPe Domain Sequences for d1jlla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlla2 c.23.4.1 (A:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]} ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl
Timeline for d1jlla2: