SCOP 1.59: Domain d1jlfa1: 1jlf A:430-539

Lineage for d1jlfa1 (1jlf A:430-539)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (57 PDB entries)

8. Domain d1jlfa1: 1jlf A:430-539 [66845]
   Other proteins in same PDB: d1jlfa2, d1jlfb1

Details for d1jlfa1

PDB Entry: 1jlf, 2.6 Å

PDB Description: crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with nevirapine

SCOP Domain Sequences for d1jlfa1:

Sequence; same for both SEQRES and ATOM records:

>d1jlfa1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Timeline for d1jlfa1:

• d1jlfa1 is new in SCOP 1.59
  
• d1jlfa1 appears in SCOP 1.61
  
• d1jlfa1 appears in the current release, SCOPe 2.08