Lineage for d1jlea2 (1jle A:1-429)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618312Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 618313Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 618314Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (83 PDB entries)
  8. 618430Domain d1jlea2: 1jle A:1-429 [66843]
    Other proteins in same PDB: d1jlea1
    mutant

Details for d1jlea2

PDB Entry: 1jle (more details), 2.8 Å

PDB Description: crystal structure of y188c mutant hiv-1 reverse transcriptase
PDB Compounds: (A:)

SCOP Domain Sequences for d1jlea2:

Sequence, based on SEQRES records: (download)

>d1jlea2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
yqymddlavgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Sequence, based on observed residues (ATOM records): (download)

>d1jlea2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpqwplteekikalveictemekegkiskinpyntpvfklvdf
relnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkytaftipsinn
etpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlavgsdleigq
hrtkieelrqhllrwglttpkhqkeppflwmgyelhpdkwtvqpivlpekdswtvndiqk
lvgklnwasqiypgikvrqlakllrgtkalteviplteeaelelaenreilkepvhgvyy
dpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittes
iviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyql

SCOP Domain Coordinates for d1jlea2:

Click to download the PDB-style file with coordinates for d1jlea2.
(The format of our PDB-style files is described here.)

Timeline for d1jlea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jlea1
View in 3D
Domains from other chains:
(mouse over for more information)
d1jleb_