SCOP 1.65: Domain d1jlea1: 1jle A:430-549

Lineage for d1jlea1 (1jle A:430-549)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (65 PDB entries)

8. Domain d1jlea1: 1jle A:430-549 [66842]
   Other proteins in same PDB: d1jlea2, d1jleb_
   mutant

Details for d1jlea1

PDB Entry: 1jle, 2.8 Å

PDB Description: crystal structure of y188c mutant hiv-1 reverse transcriptase

SCOP Domain Sequences for d1jlea1:

Sequence, based on SEQRES records:

>d1jlea1 c.55.3.1 (A:430-549) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd

Sequence, based on observed residues (ATOM records):

>d1jlea1 c.55.3.1 (A:430-549) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdganrlgkagyvtnrgrqkvvtltdttnqktelqaiylalqdsglev
nivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd

Timeline for d1jlea1:

• d1jlea1 first appeared in SCOP 1.59
  
• d1jlea1 appears in SCOP 1.63
  
• d1jlea1 appears in SCOP 1.67
  
• d1jlea1 appears in the current release, SCOPe 2.08