Lineage for d1jlca2 (1jlc A:1-429)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339256Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 339257Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 339321Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 339322Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 339323Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (63 PDB entries)
  8. 339405Domain d1jlca2: 1jlc A:1-429 [66840]
    Other proteins in same PDB: d1jlca1
    complexed with ftc; mutant

Details for d1jlca2

PDB Entry: 1jlc (more details), 3 Å

PDB Description: crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with pett-2
PDB Compounds: (A:)

SCOP Domain Sequences for d1jlca2:

Sequence, based on SEQRES records: (download)

>d1jlca2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
cqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Sequence, based on observed residues (ATOM records): (download)

>d1jlca2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrk
ytaftipsiiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivicqymddlyvgsd
leigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivlpekdsw
tvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelelaenreilke
pvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteav
qkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyql

SCOP Domain Coordinates for d1jlca2:

Click to download the PDB-style file with coordinates for d1jlca2.
(The format of our PDB-style files is described here.)

Timeline for d1jlca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jlca1
View in 3D
Domains from other chains:
(mouse over for more information)
d1jlcb_