Lineage for d1jl9a_ (1jl9 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2582604Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2582769Protein Epidermal growth factor, EGF [57215] (2 species)
  7. 2582770Species Human (Homo sapiens) [TaxId:9606] [69939] (5 PDB entries)
  8. 2582772Domain d1jl9a_: 1jl9 A: [66831]

Details for d1jl9a_

PDB Entry: 1jl9 (more details), 3 Å

PDB Description: Crystal Structure of Human Epidermal Growth Factor
PDB Compounds: (A:) epidermal growth factor

SCOPe Domain Sequences for d1jl9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl9a_ g.3.11.1 (A:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}
cplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdl

SCOPe Domain Coordinates for d1jl9a_:

Click to download the PDB-style file with coordinates for d1jl9a_.
(The format of our PDB-style files is described here.)

Timeline for d1jl9a_:

2582772
d1jl9a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1jl9b_