Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.6: Leucine rich effector protein YopM [69433] (1 protein) this is a repeat family; one repeat unit is 1g9u A:139-161 found in domain |
Protein Leucine rich effector protein YopM [69434] (1 species) |
Species Yersinia pestis [TaxId:632] [69435] (2 PDB entries) |
Domain d1jl5a_: 1jl5 A: [66830] complexed with ca |
PDB Entry: 1jl5 (more details), 2.1 Å
SCOPe Domain Sequences for d1jl5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} kskteyynawsewernappgngeqremavsrlrdcldrqahelelnnlglsslpelpphl eslvascnsltelpelpqslksllvdnnnlkalsdlpplleylgvsnnqleklpelqnss flkiidvdnnslkklpdlppslefiaagnnqleelpelqnlpfltaiyadnnslkklpdl plslesivagnnileelpelqnlpflttiyadnnllktlpdlppslealnvrdnyltdlp elpqsltfldvsenifsglselppnlyylnassneirslcdlppsleelnvsnnklielp alpprlerliasfnhlaevpelpqnlkqlhveynplrefpdipesvedlrmns
Timeline for d1jl5a_: