SCOPe 2.05: Domain d1jl3d_: 1jl3 D:

Lineage for d1jl3d_ (1jl3 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
   automatically mapped to Pfam PF01451

6. Protein Arsenate reductase ArsC [69504] (3 species)
   also has a phosphotyrosine phosphatase activity

7. Species Bacillus subtilis [TaxId:1423] [69506] (3 PDB entries)

8. Domain d1jl3d_: 1jl3 D: [66829]
   complexed with so4

Details for d1jl3d_

PDB Entry: 1jl3, 1.6 Å

PDB Description: crystal structure of b. subtilis arsc

PDB Compounds: (D:) arsenate reductase

SCOPe Domain Sequences for d1jl3d_:

Sequence, based on SEQRES records:

>d1jl3d_ c.44.1.1 (D:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]}
kiiyflctgnscrsqmaegwakqylgdewkvysagieahglnpnavkamkevgidisnqt
sdiidsdilnnadlvvtlcgdaadkcpmtpphvkrehwgfddparaqgteeekwaffqrv
rdeignrlkefaetgk

Sequence, based on observed residues (ATOM records):

>d1jl3d_ c.44.1.1 (D:) Arsenate reductase ArsC {Bacillus subtilis [TaxId: 1423]}
kiiyflctgnscrsqmaegwakqylgdewkvysagieahglnpnavkamkevgidisnqt
sdiidsdilnnadlvvtlcgvkrehwgfddparaqgteeekwaffqrvrdeignrlkefa
etgk

Timeline for d1jl3d_:

• d1jl3d_ first appeared in SCOP 1.59
  
• d1jl3d_ appears in SCOPe 2.04
  
• d1jl3d_ appears in SCOPe 2.06
  
• d1jl3d_ appears in the current release, SCOPe 2.08