SCOP 1.69: Domain d1jl3a_: 1jl3 A:

Lineage for d1jl3a_ (1jl3 A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (1 family)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (2 proteins)

6. Protein Arsenate reductase ArsC [69504] (2 species)
   also has a phosphotyrosine phosphatase activity

7. Species Bacillus subtilis [TaxId:1423] [69506] (1 PDB entry)

8. Domain d1jl3a_: 1jl3 A: [66826]

Details for d1jl3a_

PDB Entry: 1jl3, 1.6 Å

PDB Description: crystal structure of b. subtilis arsc

SCOP Domain Sequences for d1jl3a_:

Sequence; same for both SEQRES and ATOM records:

>d1jl3a_ c.44.1.1 (A:) Arsenate reductase ArsC {Bacillus subtilis}
nkiiyflctgnscrsqmaegwakqylgdewkvysagieahglnpnavkamkevgidisnq
tsdiidsdilnnadlvvtlcgdaadkcpmtpphvkrehwgfddparaqgteeekwaffqr
vrdeignrlkefaetgk

Timeline for d1jl3a_:

• d1jl3a_ first appeared in SCOP 1.59
  
• d1jl3a_ appears in SCOP 1.67
  
• d1jl3a_ appears in SCOP 1.71
  
• d1jl3a_ appears in the current release, SCOPe 2.08