SCOPe 2.06: Domain d1jl2a_: 1jl2 A:

Lineage for d1jl2a_ (1jl2 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein RNase H (RNase HI) [53100] (4 species)

7. Species synthetic, Escherichia coli/Thermus thermophilus chimera [69532] (1 PDB entry)

8. Domain d1jl2a_: 1jl2 A: [66822]

Details for d1jl2a_

PDB Entry: 1jl2, 1.76 Å

PDB Description: crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h

PDB Compounds: (A:) chimeric RNase H

SCOPe Domain Sequences for d1jl2a_:

Sequence; same for both SEQRES and ATOM records:

>d1jl2a_ c.55.3.1 (A:) RNase H (RNase HI) {synthetic, Escherichia coli/Thermus thermophilus chimera}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
aevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfhfv
kghaghpeneradelaraaamnptledtgy

Timeline for d1jl2a_:

• d1jl2a_ first appeared in SCOP 1.59
  
• d1jl2a_ appears in SCOPe 2.05
  
• d1jl2a_ appears in SCOPe 2.07
  
• d1jl2a_ appears in the current release, SCOPe 2.08