Lineage for d1jkxc_ (1jkx C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468682Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2468683Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2468684Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2468691Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)
  7. 2468692Species Escherichia coli [TaxId:562] [53331] (9 PDB entries)
  8. 2468698Domain d1jkxc_: 1jkx C: [66815]
    complexed with 138

Details for d1jkxc_

PDB Entry: 1jkx (more details), 1.6 Å

PDB Description: unexpected formation of an epoxide-derived multisubstrate adduct inhibitor on the active site of gar transformylase
PDB Compounds: (C:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d1jkxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkxc_ c.65.1.1 (C:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli [TaxId: 562]}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

SCOPe Domain Coordinates for d1jkxc_:

Click to download the PDB-style file with coordinates for d1jkxc_.
(The format of our PDB-style files is described here.)

Timeline for d1jkxc_: