Lineage for d1jkxa_ (1jkx A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125535Fold c.65: Formyltransferase [53327] (1 superfamily)
  4. 125536Superfamily c.65.1: Formyltransferase [53328] (1 family) (S)
  5. 125537Family c.65.1.1: Formyltransferase [53329] (2 protein domains)
  6. 125538Protein Glycinamide ribonucleotide transformylase, GART [53330] (1 species)
  7. 125539Species Escherichia coli [TaxId:562] [53331] (9 PDB entries)
  8. 125540Domain d1jkxa_: 1jkx A: [66813]

Details for d1jkxa_

PDB Entry: 1jkx (more details), 1.6 Å

PDB Description: unexpected formation of an epoxide-derived multisubstrate adduct inhibitor on the active site of gar transformylase

SCOP Domain Sequences for d1jkxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Escherichia coli}
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

SCOP Domain Coordinates for d1jkxa_:

Click to download the PDB-style file with coordinates for d1jkxa_.
(The format of our PDB-style files is described here.)

Timeline for d1jkxa_: