SCOPe 2.07: Domain d1jkna1: 1jkn A:6-165

Lineage for d1jkna1 (1jkn A:6-165)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species)

7. Species Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId:3871] [64368] (2 PDB entries)

8. Domain d1jkna1: 1jkn A:6-165 [66808]
   Other proteins in same PDB: d1jkna2
   complexed with atp

Details for d1jkna1

PDB Entry: 1jkn

PDB Description: solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius complexed with atp

PDB Compounds: (A:) diadenosine 5',5'''-p1,p4-tetraphosphate hydrolase

SCOPe Domain Sequences for d1jkna1:

Sequence; same for both SEQRES and ATOM records:

>d1jkna1 d.113.1.1 (A:6-165) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]}
mdsppegyrrnvgiclmnndkkifaasrldipdawqmpqggidegedprnaairelreet
gvtsaeviaevpywltydfppkvreklniqwgsdwkgqaqkwflfkftgqdqeinllgdg
sekpefgewswvtpeqlidltvefkkpvykevlsvfaphl

Timeline for d1jkna1:

• d1jkna1 first appeared in SCOP 1.59, called d1jkna_
  
• d1jkna1 appears in SCOPe 2.06
  
• d1jkna1 appears in the current release, SCOPe 2.08