![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species) |
![]() | Species Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId:3871] [64368] (2 PDB entries) |
![]() | Domain d1jkna1: 1jkn A:6-165 [66808] Other proteins in same PDB: d1jkna2 complexed with atp |
PDB Entry: 1jkn (more details)
SCOPe Domain Sequences for d1jkna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jkna1 d.113.1.1 (A:6-165) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} mdsppegyrrnvgiclmnndkkifaasrldipdawqmpqggidegedprnaairelreet gvtsaeviaevpywltydfppkvreklniqwgsdwkgqaqkwflfkftgqdqeinllgdg sekpefgewswvtpeqlidltvefkkpvykevlsvfaphl
Timeline for d1jkna1: