Lineage for d1jkna_ (1jkn A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.113: Nudix [55810] (1 superfamily) Superfamily d.113.1: Nudix [55811] (2 families) 
Family d.113.1.1: MutT-like [55812] (3 proteins) 
Protein Diadenosine tetraphosphate hydrolase [64367] (1 species) Species Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId:3871] [64368] (2 PDB entries) 
Domain d1jkna_: 1jkn A: [66808]
Details for d1jkna_
PDB Entry: 1jkn (more details)
PDB Description: solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius complexed with atp
SCOP Domain Sequences for d1jkna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase {Narrow-leaved blue lupine (Lupinus angustifolius)}
gplgsmdsppegyrrnvgiclmnndkkifaasrldipdawqmpqggidegedprnaaire
lreetgvtsaeviaevpywltydfppkvreklniqwgsdwkgqaqkwflfkftgqdqein
llgdgsekpefgewswvtpeqlidltvefkkpvykevlsvfaphl
SCOP Domain Coordinates for d1jkna_:
Click to download the PDB-style file with coordinates for d1jkna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jkna_:
- d1jkna_ is new in SCOP 1.59
- d1jkna_ appears in SCOP 1.61
- d1jkna_ appears in the current release, SCOPe 2.08, called d1jkna1
View in 3D