SCOP 1.61: Domain d1jkje1: 1jkj E:239-385

Lineage for d1jkje1 (1jkj E:239-385)

Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
Species Escherichia coli [TaxId:562] [52216] (6 PDB entries)
Domain d1jkje1: 1jkj E:239-385 [66806]
Other proteins in same PDB: d1jkja1, d1jkja2, d1jkjb2, d1jkjd1, d1jkjd2, d1jkje2

Details for d1jkje1

PDB Entry: 1jkj (more details), 2.35 Å

PDB Description: E. coli SCS

SCOP Domain Sequences for d1jkje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkje1 c.23.4.1 (E:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav

SCOP Domain Coordinates for d1jkje1:

Click to download the PDB-style file with coordinates for d1jkje1.
(The format of our PDB-style files is described here.)

Timeline for d1jkje1: