Lineage for d1jkjd2 (1jkj D:122-287)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158469Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 1158470Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 1158477Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (3 species)
  7. 1158478Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)
  8. 1158484Domain d1jkjd2: 1jkj D:122-287 [66805]
    Other proteins in same PDB: d1jkja1, d1jkjb1, d1jkjb2, d1jkjd1, d1jkje1, d1jkje2
    complexed with coa, gol, po4, so4

Details for d1jkjd2

PDB Entry: 1jkj (more details), 2.35 Å

PDB Description: E. coli SCS
PDB Compounds: (D:) succinyl-CoA synthetase alpha subunit

SCOPe Domain Sequences for d1jkjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkjd2 c.23.4.1 (D:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl

SCOPe Domain Coordinates for d1jkjd2:

Click to download the PDB-style file with coordinates for d1jkjd2.
(The format of our PDB-style files is described here.)

Timeline for d1jkjd2: