Lineage for d1jkgb_ (1jkg B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1197160Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1197184Family d.17.4.2: NTF2-like [54431] (6 proteins)
  6. 1197198Protein NTF2-like domain of Tip associating protein, TAP [69677] (1 species)
  7. 1197199Species Human (Homo sapiens) [TaxId:9606] [69678] (2 PDB entries)
  8. 1197200Domain d1jkgb_: 1jkg B: [66796]
    Other proteins in same PDB: d1jkga_

Details for d1jkgb_

PDB Entry: 1jkg (more details), 1.9 Å

PDB Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA nuclear export factor
PDB Compounds: (B:) tap

SCOPe Domain Sequences for d1jkgb_:

Sequence, based on SEQRES records: (download)

>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}
appckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfipqnpar
sslaeyfkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtst
llcfsvngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafa
mpaptp

Sequence, based on observed residues (ATOM records): (download)

>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}
appckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfisslaey
fkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtstllcfsv
ngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafampaptp

SCOPe Domain Coordinates for d1jkgb_:

Click to download the PDB-style file with coordinates for d1jkgb_.
(The format of our PDB-style files is described here.)

Timeline for d1jkgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jkga_