Lineage for d1jkgb1 (1jkg B:371-555)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162017Family d.17.4.2: NTF2-like [54431] (6 protein domains)
  6. 2162031Protein NTF2-like domain of Tip associating protein, TAP [69677] (1 species)
  7. 2162032Species Human (Homo sapiens) [TaxId:9606] [69678] (2 PDB entries)
  8. 2162033Domain d1jkgb1: 1jkg B:371-555 [66796]
    Other proteins in same PDB: d1jkga_, d1jkgb2

Details for d1jkgb1

PDB Entry: 1jkg (more details), 1.9 Å

PDB Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA nuclear export factor
PDB Compounds: (B:) tap

SCOPe Domain Sequences for d1jkgb1:

Sequence, based on SEQRES records: (download)

>d1jkgb1 d.17.4.2 (B:371-555) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}
ppckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfipqnpars
slaeyfkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtstl
lcfsvngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafam
paptp

Sequence, based on observed residues (ATOM records): (download)

>d1jkgb1 d.17.4.2 (B:371-555) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}
ppckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfisslaeyf
kdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtstllcfsvn
gvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafampaptp

SCOPe Domain Coordinates for d1jkgb1:

Click to download the PDB-style file with coordinates for d1jkgb1.
(The format of our PDB-style files is described here.)

Timeline for d1jkgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jkgb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jkga_