Lineage for d1jkeb_ (1jke B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920849Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2920850Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2920851Family c.110.1.1: DTD-like [69501] (2 proteins)
    Pfam PF02580
  6. 2920852Protein D-Tyr tRNAtyr deacylase, DTD [69502] (2 species)
    formerly hypothetical protein YihZ
  7. 2920853Species Escherichia coli [TaxId:562] [69503] (1 PDB entry)
  8. 2920855Domain d1jkeb_: 1jke B: [66792]
    complexed with zn

Details for d1jkeb_

PDB Entry: 1jke (more details), 1.55 Å

PDB Description: D-Tyr tRNATyr deacylase from Escherichia coli
PDB Compounds: (B:) D-Tyr-tRNATyr deacylase

SCOPe Domain Sequences for d1jkeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkeb_ c.110.1.1 (B:) D-Tyr tRNAtyr deacylase, DTD {Escherichia coli [TaxId: 562]}
mialiqrvtrasvtvegevtgeigagllvllgvekdddeqkanrlcervlgyrifsdaeg
kmnlnvqqaggsvlvvsqftlaadtergmrpsfskgaspdraealydyfvercrqqemnt
qtgrfaadmqvslvndgpvtfwlqv

SCOPe Domain Coordinates for d1jkeb_:

Click to download the PDB-style file with coordinates for d1jkeb_.
(The format of our PDB-style files is described here.)

Timeline for d1jkeb_: