SCOP 1.73: Domain d1jk3a_: 1jk3 A:

Lineage for d1jk3a_ (1jk3 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (15 PDB entries)

8. Domain d1jk3a_: 1jk3 A: [66790]
   complexed with bat, ca, zn; mutant

Details for d1jk3a_

PDB Entry: 1jk3, 1.09 Å

PDB Description: crystal structure of human mmp-12 (macrophage elastase) at true atomic resolution

PDB Compounds: (A:) Macrophage metalloelastase

SCOP Domain Sequences for d1jk3a_:

Sequence; same for both SEQRES and ATOM records:

>d1jk3a_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d1jk3a_:

• d1jk3a_ first appeared in SCOP 1.59
  
• d1jk3a_ appears in SCOP 1.71
  
• d1jk3a_ appears in SCOP 1.75
  
• d1jk3a_ appears in the current release, SCOPe 2.08