Lineage for d1jk3a_ (1jk3 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415443Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 415444Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 415641Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 415687Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 415688Species Human (Homo sapiens) [TaxId:9606] [69781] (4 PDB entries)
  8. 415689Domain d1jk3a_: 1jk3 A: [66790]
    complexed with bat, ca, zn; mutant

Details for d1jk3a_

PDB Entry: 1jk3 (more details), 1.09 Å

PDB Description: crystal structure of human mmp-12 (macrophage elastase) at true atomic resolution

SCOP Domain Sequences for d1jk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jk3a_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens)}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOP Domain Coordinates for d1jk3a_:

Click to download the PDB-style file with coordinates for d1jk3a_.
(The format of our PDB-style files is described here.)

Timeline for d1jk3a_: