Lineage for d1jk3a_ (1jk3 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins) Protein Macrophage elastase (MMP-12) [69780] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69781] (1 PDB entry) 
Domain d1jk3a_: 1jk3 A: [66790]
Details for d1jk3a_
PDB Entry: 1jk3 (more details), 1.09 Å
PDB Description: crystal structure of human mmp-12 (macrophage elastase) at true atomic resolution
SCOP Domain Sequences for d1jk3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jk3a_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens)}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhaighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg
SCOP Domain Coordinates for d1jk3a_:
Click to download the PDB-style file with coordinates for d1jk3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jk3a_:
- d1jk3a_ is new in SCOP 1.59
- d1jk3a_ appears in SCOP 1.61
- d1jk3a_ appears in the current release, SCOPe 2.08
View in 3D