Lineage for d1jjwc_ (1jjw C:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875596Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 875597Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 875747Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 875748Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 875812Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)
  8. 875818Domain d1jjwc_: 1jjw C: [66783]
    complexed with k

Details for d1jjwc_

PDB Entry: 1jjw (more details), 1.9 Å

PDB Description: Structure of Haemophilus influenzae HslV Protein at 1.9 A Resolution
PDB Compounds: (C:) ATP-dependent protease hslv

SCOP Domain Sequences for d1jjwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjwc_ d.153.1.4 (C:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

SCOP Domain Coordinates for d1jjwc_:

Click to download the PDB-style file with coordinates for d1jjwc_.
(The format of our PDB-style files is described here.)

Timeline for d1jjwc_: