Lineage for d1jjwc_ (1jjw C:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) 
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) Protein HslV (ClpQ) protease [56258] (2 species) Species Haemophilus influenzae [TaxId:727] [56260] (3 PDB entries) 
Domain d1jjwc_: 1jjw C: [66783]
Details for d1jjwc_
PDB Entry: 1jjw (more details), 1.9 Å
PDB Description: Structure of Haemophilus influenzae HslV Protein at 1.9 A Resolution
SCOP Domain Sequences for d1jjwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjwc_ d.153.1.4 (C:) HslV (ClpQ) protease {Haemophilus influenzae}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
SCOP Domain Coordinates for d1jjwc_:
Click to download the PDB-style file with coordinates for d1jjwc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jjwc_:
- d1jjwc_ is new in SCOP 1.59
- d1jjwc_ appears in SCOP 1.61
- d1jjwc_ appears in the current release, SCOPe 2.08
View in 3D
