SCOPe 2.03: Domain d1jjwb_: 1jjw B:

Lineage for d1jjwb_ (1jjw B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein HslV (ClpQ) protease [56258] (4 species)
   dodecameric prokaryotic homologue of proteasome

7. Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)

8. Domain d1jjwb_: 1jjw B: [66782]
   complexed with k

Details for d1jjwb_

PDB Entry: 1jjw, 1.9 Å

PDB Description: Structure of Haemophilus influenzae HslV Protein at 1.9 A Resolution

PDB Compounds: (B:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1jjwb_:

Sequence; same for both SEQRES and ATOM records:

>d1jjwb_ d.153.1.4 (B:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

Timeline for d1jjwb_:

• d1jjwb_ first appeared in SCOP 1.59
  
• d1jjwb_ appears in SCOPe 2.02
  
• d1jjwb_ appears in SCOPe 2.04
  
• d1jjwb_ appears in the current release, SCOPe 2.08