Lineage for d1jjub_ (1jju B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1554689Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1554711Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 1554732Family b.69.2.2: Quinohemoprotein amine dehydrogenase B chain [69309] (1 protein)
    less regular propeller with imperfect sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
    this is a repeat family; one repeat unit is 1jmx B:256-296 found in domain
  6. 1554733Protein Quinohemoprotein amine dehydrogenase B chain [69310] (2 species)
  7. 1554734Species Paracoccus denitrificans [TaxId:266] [69311] (2 PDB entries)
  8. 1554736Domain d1jjub_: 1jju B: [66779]
    Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua3, d1jjua4, d1jjua5, d1jjuc_
    complexed with hem, na, tbu

Details for d1jjub_

PDB Entry: 1jju (more details), 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking
PDB Compounds: (B:) quinohemoprotein amine dehydrogenase

SCOPe Domain Sequences for d1jjub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjub_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}
rdyilaparpdklvvidtekmavdkvitiadagptpmvpmvapggriayatvnkseslvk
idlvtgetlgridlstpeervkslfgaalspdgktlaiyespvrlelthfevqptrvaly
daetlsrrkafeaprqitmlawardgsklyglgrdlhvmdpeagtlvedkpiqsweaety
aqpdvlavwnqhessgvmatpfytarkdidpadptayrtglltmdletgemamrevrimd
vfyfstavnpaktrafgaynvlesfdleknasikrvplphsyysvnvstdgstvwlggal
gdlaaydaetlekkgqvdlpgnasmslasvrlftrde

SCOPe Domain Coordinates for d1jjub_:

Click to download the PDB-style file with coordinates for d1jjub_.
(The format of our PDB-style files is described here.)

Timeline for d1jjub_: