SCOPe 2.04: Domain d1jjua5: 1jju A:166-273

Lineage for d1jjua5 (1jju A:166-273)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.4: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69298] (1 family)

5. Family b.61.4.1: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69299] (1 protein)

6. Protein Quinohemoprotein amine dehydrogenase A chain, domain 3 [69300] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [69301] (2 PDB entries)

8. Domain d1jjua5: 1jju A:166-273 [66778]
   Other proteins in same PDB: d1jjua1, d1jjua2, d1jjua3, d1jjua4, d1jjub_, d1jjuc_
   complexed with hem, na, tbu

Details for d1jjua5

PDB Entry: 1jju, 2.05 Å

PDB Description: Structure of a Quinohemoprotein Amine Dehydrogenase with a Unique Redox Cofactor and Highly Unusual Crosslinking

PDB Compounds: (A:) quinohemoprotein amine dehydrogenase

SCOPe Domain Sequences for d1jjua5:

Sequence; same for both SEQRES and ATOM records:

>d1jjua5 b.61.4.1 (A:166-273) Quinohemoprotein amine dehydrogenase A chain, domain 3 {Paracoccus denitrificans [TaxId: 266]}
pdayaddasgayvlagrqpgrgdytgrlvlkkagedyevtmtldfadgsrsfsgtgrilg
agewratlsdgtvtirqifalqdgrfsgrwhdadsdviggrlaavkad

Timeline for d1jjua5:

• d1jjua5 first appeared in SCOP 1.59
  
• d1jjua5 appears in SCOPe 2.03
  
• d1jjua5 appears in SCOPe 2.05
  
• d1jjua5 appears in the current release, SCOPe 2.08