Class a: All alpha proteins [46456] (286 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.7: Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68956] (1 protein) |
Protein Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68957] (2 species) duplication: tandem repeat of two cytochrome c-like domains |
Species Paracoccus denitrificans [TaxId:266] [68958] (2 PDB entries) |
Domain d1jjua2: 1jju A:86-165 [66775] Other proteins in same PDB: d1jjua3, d1jjua4, d1jjua5, d1jjub_, d1jjuc_ complexed with hem, na, tbu |
PDB Entry: 1jju (more details), 2.05 Å
SCOPe Domain Sequences for d1jjua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjua2 a.3.1.7 (A:86-165) Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 {Paracoccus denitrificans [TaxId: 266]} vawdegpdtsmtqtcgrchsyarvalqrrtpedwkhlvnfhlgqfptleyqalardrdww giaqaeiipflartyplgea
Timeline for d1jjua2:
View in 3D Domains from same chain: (mouse over for more information) d1jjua1, d1jjua3, d1jjua4, d1jjua5 |