Lineage for d1jjsa_ (1jjs A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101926Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
  4. 101927Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) (S)
  5. 101928Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (2 proteins)
  6. 101932Protein Nuclear receptor coactivator CBP/p300 ibid domain [69127] (1 species)
  7. 101933Species Mouse (Mus musculus) [TaxId:10090] [69128] (2 PDB entries)
  8. 101935Domain d1jjsa_: 1jjs A: [66773]

Details for d1jjsa_

PDB Entry: 1jjs (more details)

PDB Description: nmr structure of ibid, a domain of cbp/p300

SCOP Domain Sequences for d1jjsa_:

Sequence, based on SEQRES records: (download)

>d1jjsa_ a.153.1.1 (A:) Nuclear receptor coactivator CBP/p300 ibid domain {Mouse (Mus musculus)}
alqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan

Sequence, based on observed residues (ATOM records): (download)

>d1jjsa_ a.153.1.1 (A:) Nuclear receptor coactivator CBP/p300 ibid domain {Mouse (Mus musculus)}
alqdllrtlkspsspqvlnilksnpqlmaafikqrtakyvan

SCOP Domain Coordinates for d1jjsa_:

Click to download the PDB-style file with coordinates for d1jjsa_.
(The format of our PDB-style files is described here.)

Timeline for d1jjsa_: