Lineage for d1jjsa_ (1jjs A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735240Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
    3 helices, non-globular array; forms interlocked heterodimers with its targets
  4. 2735241Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) (S)
    not a true superfamily
  5. 2735242Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 proteins)
  6. 2735249Protein Nuclear receptor coactivator CBP/p300 ibid domain [69127] (1 species)
  7. 2735250Species Mouse (Mus musculus) [TaxId:10090] [69128] (2 PDB entries)
  8. 2735252Domain d1jjsa_: 1jjs A: [66773]
    free form

Details for d1jjsa_

PDB Entry: 1jjs (more details)

PDB Description: nmr structure of ibid, a domain of cbp/p300
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d1jjsa_:

Sequence, based on SEQRES records: (download)

>d1jjsa_ a.153.1.1 (A:) Nuclear receptor coactivator CBP/p300 ibid domain {Mouse (Mus musculus) [TaxId: 10090]}
alqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan

Sequence, based on observed residues (ATOM records): (download)

>d1jjsa_ a.153.1.1 (A:) Nuclear receptor coactivator CBP/p300 ibid domain {Mouse (Mus musculus) [TaxId: 10090]}
alqdllrtlkspsspqvlnilksnpqlmaafikqrtakyvan

SCOPe Domain Coordinates for d1jjsa_:

Click to download the PDB-style file with coordinates for d1jjsa_.
(The format of our PDB-style files is described here.)

Timeline for d1jjsa_: