Class a: All alpha proteins [46456] (151 folds) |
Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies) |
Superfamily a.140.2: SAP domain [68906] (1 family) |
Family a.140.2.1: SAP domain [68907] (2 proteins) |
Protein DNA binding C-terminal domain of ku70 [68908] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [68909] (2 PDB entries) |
Domain d1jjra_: 1jjr A: [66772] |
PDB Entry: 1jjr (more details)
SCOP Domain Sequences for d1jjra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jjra_ a.140.2.1 (A:) DNA binding C-terminal domain of ku70 {Human (Homo sapiens)} kveyseeelkthiskgtlgkftvpmlkeacrayglksglkkqellealtkhfqd
Timeline for d1jjra_: