Lineage for d1jjra_ (1jjr A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101768Fold a.140: LEM/SAP HeH motif [63450] (4 superfamilies)
  4. 101778Superfamily a.140.2: SAP domain [68906] (1 family) (S)
  5. 101779Family a.140.2.1: SAP domain [68907] (2 proteins)
  6. 101780Protein DNA binding C-terminal domain of ku70 [68908] (1 species)
  7. 101781Species Human (Homo sapiens) [TaxId:9606] [68909] (2 PDB entries)
  8. 101783Domain d1jjra_: 1jjr A: [66772]

Details for d1jjra_

PDB Entry: 1jjr (more details)

PDB Description: the three-dimensional structure of the c-terminal dna binding domain of human ku70

SCOP Domain Sequences for d1jjra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jjra_ a.140.2.1 (A:) DNA binding C-terminal domain of ku70 {Human (Homo sapiens)}
kveyseeelkthiskgtlgkftvpmlkeacrayglksglkkqellealtkhfqd

SCOP Domain Coordinates for d1jjra_:

Click to download the PDB-style file with coordinates for d1jjra_.
(The format of our PDB-style files is described here.)

Timeline for d1jjra_: